MRPL13 antibody (Middle Region)

Catalog No. ABIN632315

Product Details anti-MRPL13 Antibody

Target: MRPL13 (Mitochondrial Ribosomal Protein L13 (MRPL13))

Binding Specificity: Middle Region

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This MRPL13 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: MRPL13 antibody was raised against the middle region of MRPL13

Purification: Affinity purified

Immunogen: MRPL13 antibody was raised using the middle region of MRPL13 corresponding to a region with amino acids AIYGMLPKNLHRRTMMERLHLFPDEYIPEDILKNLVEELPQPRKIPKRLD

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

MRPL13 Blocking Peptide, catalog no. 33R-1286, is also available for use as a blocking control in assays to test for specificity of this MRPL13 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MRPL13 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for MRPL13

Target: MRPL13 (Mitochondrial Ribosomal Protein L13 (MRPL13))

Alternative Name: MRPL13 (MRPL13 Products)

Synonyms: CG10602 antibody, CG10603 antibody, Dmel\\CG10603 antibody, L13 antibody, anon-EST:fe3C4 antibody, GB12738 antibody, MGC135435 antibody, zgc:109948 antibody, MRPL13 antibody, YK105 antibody, L13A antibody, L13mt antibody, RPL13 antibody, RPML13 antibody, 1110002D09Rik antibody, mitochondrial ribosomal protein L13 antibody, 39S ribosomal protein L13, mitochondrial antibody, mitochondrial ribosomal protein L13 S homeolog antibody, mitochondrial 54S ribosomal protein YmL13 antibody, Putative mitochondrial ribosomal protein L13 antibody, mRpL13 antibody, LOC413928 antibody, MRPL13 antibody, mrpl13.S antibody, mrpl13 antibody, LOC770396 antibody, mrpL13 antibody, Mrpl13 antibody

Background: Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% protein to rRNA composition compared to prokaryotic ribosomes, where this ratio is reversed. Another difference between mammalian mitoribosomes and prokaryotic ribosomes is that the latter contain a 5S rRNA.

Molecular Weight: 21 kDa (MW of target protein)