FBXO22 antibody (Middle Region)

Catalog No. ABIN632326

Product Details anti-FBXO22 Antibody

Target: FBXO22 (F-Box Protein 22 (FBXO22))

Binding Specificity: Middle Region

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This FBXO22 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: FBXO22 antibody was raised against the middle region of FBXO22

Purification: Affinity purified

Immunogen: FBXO22 antibody was raised using the middle region of FBXO22 corresponding to a region with amino acids CCKVGASNYLQQVVSTFSDMNIILAGGQVDNLSSLTSEKYVLCASDFVCE

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

FBXO22 Blocking Peptide, catalog no. 33R-1651, is also available for use as a blocking control in assays to test for specificity of this FBXO22 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FBXO22 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for FBXO22

Target: FBXO22 (F-Box Protein 22 (FBXO22))

Alternative Name: FBXO22 (FBXO22 Products)

Synonyms: FBXO22 antibody, DKFZp469L0535 antibody, fbxo22 antibody, MGC146708 antibody, si:busm1-132m23.3 antibody, FBX22 antibody, FISTC1 antibody, 0610033L19Rik antibody, 1600016C16Rik antibody, F-box protein 22 antibody, FBXO22 antibody, fbxo22 antibody, Fbxo22 antibody

Background: FBXO22 is a member of the F-box protein family which is characterized by an approximately 40 amino acid motif, the F-box. The F-box proteins constitute one of the four subunits of the ubiquitin protein ligase complex called SCFs (SKP1-cullin-F-box), which function in phosphorylation-dependent ubiquitination. The F-box proteins are divided into 3 classes: Fbws containing WD-40 domains, Fbls containing leucine-rich repeats, and Fbxs containing either different protein-protein interaction modules or no recognizable motifs. FBXO22 belongs to the Fbxs class. Two transcript variants encoding different isoforms exist for this gene.

Molecular Weight: 30 kDa (MW of target protein)

Pathways: Regulation of Muscle Cell Differentiation, Skeletal Muscle Fiber Development