CUTC antibody
-
- Target See all CUTC Antibodies
- CUTC (CutC Copper Transporter Homolog (CUTC))
-
Reactivity
- Human, Mouse
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This CUTC antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- CUTC antibody was raised using a synthetic peptide corresponding to a region with amino acids KLYGADGLVFGALTEDGHIDKELCMSLMAICRPLPVTFHRAFDMVHDPMA
- Top Product
- Discover our top product CUTC Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
CUTC Blocking Peptide, catalog no. 33R-4548, is also available for use as a blocking control in assays to test for specificity of this CUTC antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CUTC antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- CUTC (CutC Copper Transporter Homolog (CUTC))
- Alternative Name
- CUTC (CUTC Products)
- Background
- Members of the CUT family of copper transporters are associated with copper homeostasis and are involved in the uptake, storage, delivery, and efflux of copper.
- Molecular Weight
- 29 kDa (MW of target protein)
- Pathways
- Transition Metal Ion Homeostasis
-