BCL7A antibody (Middle Region)
-
- Target See all BCL7A Antibodies
- BCL7A (B-Cell CLL/lymphoma 7A (BCL7A))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This BCL7A antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- BCL7 A antibody was raised against the middle region of BCL7
- Purification
- Affinity purified
- Immunogen
- BCL7 A antibody was raised using the middle region of BCL7 corresponding to a region with amino acids CGSEVTTPENSSSPGMMDMHDDNSNQSSIADASPIKQENSSNSSPAPEPN
- Top Product
- Discover our top product BCL7A Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
BCL7A Blocking Peptide, catalog no. 33R-1704, is also available for use as a blocking control in assays to test for specificity of this BCL7A antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of BCL0 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- BCL7A (B-Cell CLL/lymphoma 7A (BCL7A))
- Alternative Name
- BCL7A (BCL7A Products)
- Synonyms
- BCL7 antibody, cb585 antibody, id:ibd1097 antibody, sb:cb585 antibody, wu:fk02d01 antibody, zgc:92023 antibody, 4432415N06Rik antibody, AI448316 antibody, bcl7a antibody, MGC89576 antibody, BCL7A antibody, BCL tumor suppressor 7A antibody, B-cell CLL/lymphoma 7A antibody, B cell CLL/lymphoma 7A antibody, B-cell CLL/lymphoma 7A L homeolog antibody, BCL7A antibody, bcl7a antibody, Bcl7a antibody, bcl7a.L antibody
- Background
- This gene is directly involved, with Myc and IgH, in a three-way gene translocation in a Burkitt lymphoma cell line. As a result of the gene translocation, the N-terminal region of the gene product is disrupted, which is thought to be related to the pathogenesis of a subset of high-grade B cell non-Hodgkin lymphoma. The N-terminal segment involved in the translocation includes the region that shares a strong sequence similarity with those of BCL7B and BCL7C. Two transcript variants encoding different isoforms have been found for this gene.
- Molecular Weight
- 25 kDa (MW of target protein)
-