BCL7A antibody (Middle Region)

Catalog No. ABIN632344

Product Details anti-BCL7A Antibody

Target: BCL7A (B-Cell CLL/lymphoma 7A (BCL7A))

Binding Specificity: Middle Region

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This BCL7A antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: BCL7 A antibody was raised against the middle region of BCL7

Purification: Affinity purified

Immunogen: BCL7 A antibody was raised using the middle region of BCL7 corresponding to a region with amino acids CGSEVTTPENSSSPGMMDMHDDNSNQSSIADASPIKQENSSNSSPAPEPN

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

BCL7A Blocking Peptide, catalog no. 33R-1704, is also available for use as a blocking control in assays to test for specificity of this BCL7A antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of BCL0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for BCL7A

Target: BCL7A (B-Cell CLL/lymphoma 7A (BCL7A))

Alternative Name: BCL7A (BCL7A Products)

Synonyms: BCL7 antibody, cb585 antibody, id:ibd1097 antibody, sb:cb585 antibody, wu:fk02d01 antibody, zgc:92023 antibody, 4432415N06Rik antibody, AI448316 antibody, bcl7a antibody, MGC89576 antibody, BCL7A antibody, BCL tumor suppressor 7A antibody, B-cell CLL/lymphoma 7A antibody, B cell CLL/lymphoma 7A antibody, B-cell CLL/lymphoma 7A L homeolog antibody, BCL7A antibody, bcl7a antibody, Bcl7a antibody, bcl7a.L antibody

Background: This gene is directly involved, with Myc and IgH, in a three-way gene translocation in a Burkitt lymphoma cell line. As a result of the gene translocation, the N-terminal region of the gene product is disrupted, which is thought to be related to the pathogenesis of a subset of high-grade B cell non-Hodgkin lymphoma. The N-terminal segment involved in the translocation includes the region that shares a strong sequence similarity with those of BCL7B and BCL7C. Two transcript variants encoding different isoforms have been found for this gene.

Molecular Weight: 25 kDa (MW of target protein)