SENP5 antibody (Middle Region)

Catalog No. ABIN632368

Product Details anti-SENP5 Antibody

Target: SENP5 (SUMO1/sentrin Specific Peptidase 5 (SENP5))

Binding Specificity: Middle Region

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SENP5 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: SENP5 antibody was raised against the middle region of SENP5

Purification: Affinity purified

Immunogen: SENP5 antibody was raised using the middle region of SENP5 corresponding to a region with amino acids LSGFLDEVMKKYGSLVPLSEKEVLGRLKDVFNEDFSNRKPFINREITNYR

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SENP5 Blocking Peptide, catalog no. 33R-5426, is also available for use as a blocking control in assays to test for specificity of this SENP5 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SENP5 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for SENP5

Target: SENP5 (SUMO1/sentrin Specific Peptidase 5 (SENP5))

Alternative Name: SENP5 (SENP5 Products)

Synonyms: 6230429P13Rik antibody, A730063F07Rik antibody, AI851888 antibody, BB189556 antibody, SMT3IP3 antibody, SENP5 antibody, Senp5 antibody, senp5 antibody, SUMO1/sentrin specific peptidase 5 antibody, SUMO/sentrin specific peptidase 5 antibody, SUMO1/sentrin specific peptidase 5 L homeolog antibody, SENP5 antibody, Senp5 antibody, senp5 antibody, senp5.L antibody

Background: The reversible posttranslational modification of proteins by the addition of small ubiquitin-like SUMO proteins is required for numerous biologic processes. SUMO-specific proteases, such as SENP5, are responsible for the initial processing of SUMO precursors to generate a C-terminal diglycine motif required for the conjugation reaction. They also have isopeptidase activity for the removal of SUMO from high molecular mass SUMO conjugates.

Molecular Weight: 87 kDa (MW of target protein)