VPS52 antibody

Catalog No. ABIN632392

Product Details anti-VPS52 Antibody

Target: VPS52 (Vacuolar Protein Sorting 52 Homolog (VPS52))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This VPS52 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: VPS52 antibody was raised using a synthetic peptide corresponding to a region with amino acids RYWEQVLALLWPRFELILEMNVQSVRSTDPQRLGGLDTRPHYITRRYAEF

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

VPS52 Blocking Peptide, catalog no. 33R-8283, is also available for use as a blocking control in assays to test for specificity of this VPS52 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of VPS52 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for VPS52

Target: VPS52 (Vacuolar Protein Sorting 52 Homolog (VPS52))

Alternative Name: VPS52 (VPS52 Products)

Synonyms: ARE1 antibody, RP5-1033B10 antibody, SAC2 antibody, SACM2L antibody, dJ1033B10.5 antibody, Are1 antibody, Sacm2l antibody, D130068D18 antibody, D430041K17Rik antibody, fb94c11 antibody, sacm2l antibody, wu:fb94c11 antibody, VPS52, GARP complex subunit antibody, VPS52 GARP complex subunit antibody, vacuolar protein sorting 52 homolog (S. cerevisiae) antibody, VPS52 antibody, Vps52 antibody, vps52 antibody

Background: This gene encodes a protein that is similar to the yeast suppressor of actin mutations 2 gene. The yeast protein forms a subunit of the tetrameric Golgi-associated retrograde protein complex that is involved in vesicle trafficking from from both early and late endosomes, back to the trans-Golgi network. This gene is located on chromosome 6 in a head-to-head orientation with the gene encoding ribosomal protein S18.

Molecular Weight: 82 kDa (MW of target protein)