COBLL1 antibody (N-Term)

Catalog No. ABIN632436

Product Details anti-COBLL1 Antibody

Target: COBLL1 (COBL-Like 1 (COBLL1))

Binding Specificity: N-Term

Reactivity: Human, Dog, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This COBLL1 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Specificity: Cobl-Like 1 antibody was raised against the N terminal of COBLL1

Purification: Affinity purified

Immunogen: Cobl-Like 1 antibody was raised using the N terminal of COBLL1 corresponding to a region with amino acids SAPATPLVNKHRPTFTRSNTISKPYISNTLPSDAPKKRRAPLPPMPASQS

Application Details

Application Notes: WB: 0.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

Cobl-Like 1 Blocking Peptide, catalog no. 33R-8308, is also available for use as a blocking control in assays to test for specificity of this Cobl-Like 1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of COBLL1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for COBLL1

Target: COBLL1 (COBL-Like 1 (COBLL1))

Alternative Name: Cobl-Like 1 (COBLL1 Products)

Synonyms: DKFZp468N1516 antibody, 1810047P18Rik antibody, Coblr1 antibody, D430044D16Rik antibody, COBLR1 antibody, cordon-bleu WH2 repeat protein like 1 antibody, cordon-bleu protein-like 1 antibody, Cobl-like 1 antibody, cordon-bleu WH2 repeat protein-like 1 antibody, COBLL1 antibody, LOC100546808 antibody, Cobll1 antibody

Background: The function of this gene remains unknown.

Molecular Weight: 128 kDa (MW of target protein)