SYDE1 antibody
-
- Target See all SYDE1 Antibodies
- SYDE1 (Synapse Defective 1, rho GTPase, Homolog 1 (SYDE1))
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This SYDE1 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- SYDE1 antibody was raised using a synthetic peptide corresponding to a region with amino acids PSPPEPEPQAPEGSQAGAEGPSSPEASRSPARGAYLQSLEPSSRRWVLGG
- Top Product
- Discover our top product SYDE1 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
SYDE1 Blocking Peptide, catalog no. 33R-7360, is also available for use as a blocking control in assays to test for specificity of this SYDE1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SYDE1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- SYDE1 (Synapse Defective 1, rho GTPase, Homolog 1 (SYDE1))
- Alternative Name
- SYDE1 (SYDE1 Products)
- Synonyms
- 7h3 antibody, 1200008N06Rik antibody, BB043000 antibody, RGD1305857 antibody, synapse defective Rho GTPase homolog 1 antibody, synapse defective 1, Rho GTPase, homolog 1 (C. elegans) antibody, SYDE1 antibody, Syde1 antibody
- Background
- SYDE1 contains 1 Rho-GAP domain. It is a GTPase activator for the Rho-type GTPases by converting them to an inactive GDP-bound state.
- Molecular Weight
- 80 kDa (MW of target protein)
-