DAPP1 antibody (Middle Region)

Catalog No. ABIN632442

Product Details anti-DAPP1 Antibody

Target: DAPP1 (Dual Adaptor of Phosphotyrosine and 3-phosphoinositides (DAPP1))

Binding Specificity: Middle Region

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This DAPP1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: DAPP1 antibody was raised against the middle region of DAPP1

Purification: Affinity purified

Immunogen: DAPP1 antibody was raised using the middle region of DAPP1 corresponding to a region with amino acids SLSVRAKDSVKHFHVEYTGYSFKFGFNEFSSLKDFVKHFANQPLIGSETG

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

DAPP1 Blocking Peptide, catalog no. 33R-8628, is also available for use as a blocking control in assays to test for specificity of this DAPP1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DAPP1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for DAPP1

Target: DAPP1 (Dual Adaptor of Phosphotyrosine and 3-phosphoinositides (DAPP1))

Alternative Name: DAPP1 (DAPP1 Products)

Synonyms: BAM32 antibody, DAPP1 antibody, zgc:111998 antibody, bam32 antibody, Bam32 antibody, dual adaptor of phosphotyrosine and 3-phosphoinositides 1 antibody, dual adaptor of phosphotyrosine and 3-phosphoinositides antibody, dual adaptor for phosphotyrosine and 3-phosphoinositides 1 antibody, DAPP1 antibody, Dapp1 antibody, dapp1 antibody

Background: DAPP1 may act as a B-cell-associated adapter that regulates B-cell antigen receptor (BCR)-signaling downstream of PI3K.

Molecular Weight: 32 kDa (MW of target protein)

Pathways: BCR Signaling