RPRD1B antibody (Middle Region)

Catalog No. ABIN632445

Product Details anti-RPRD1B Antibody

Target: RPRD1B (Regulation of Nuclear Pre-mRNA Domain Containing 1B (RPRD1B))

Binding Specificity: Middle Region

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This RPRD1B antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: RPRD1 B antibody was raised against the middle region of RPRD1

Purification: Affinity purified

Immunogen: RPRD1 B antibody was raised using the middle region of RPRD1 corresponding to a region with amino acids KKSLKRTFQQIQEEEDDDYPGSYSPQDPSAGPLLTEELIKALQDLENAAS

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

RPRD1B Blocking Peptide, catalog no. 33R-4494, is also available for use as a blocking control in assays to test for specificity of this RPRD1B antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RPRD0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for RPRD1B

Target: RPRD1B (Regulation of Nuclear Pre-mRNA Domain Containing 1B (RPRD1B))

Alternative Name: RPRD1B (RPRD1B Products)

Synonyms: fb23h08 antibody, zgc:55687 antibody, wu:fb23h08 antibody, rprd1ba antibody, MGC130705 antibody, C13H20ORF77 antibody, C20orf77 antibody, CREPT antibody, NET60 antibody, dJ1057B20.2 antibody, 2610304G08Rik antibody, 2810446G03Rik antibody, Crept antibody, RGD1304782 antibody, regulation of nuclear pre-mRNA domain containing 1B antibody, regulation of nuclear pre-mRNA domain containing 1B L homeolog antibody, rprd1b antibody, rprd1b.L antibody, RPRD1B antibody, Rprd1b antibody

Background: The function of RPRD1B protein is not widely studied, and is yet to be elucidated fully.

Molecular Weight: 37 kDa (MW of target protein)