CTDSP2 antibody
-
- Target See all CTDSP2 Antibodies
- CTDSP2 (CTD (Carboxy-terminal Domain, RNA Polymerase II, Polypeptide A) Small Phosphatase 2 (CTDSP2))
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This CTDSP2 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- CTDSP2 antibody was raised using a synthetic peptide corresponding to a region with amino acids MEHGSIITQARREDALVLTKQGLVSKSSPKKPRGRNIFKALFCCFRAQHV
- Top Product
- Discover our top product CTDSP2 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
CTDSP2 Blocking Peptide, catalog no. 33R-5924, is also available for use as a blocking control in assays to test for specificity of this CTDSP2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CTDSP2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- CTDSP2 (CTD (Carboxy-terminal Domain, RNA Polymerase II, Polypeptide A) Small Phosphatase 2 (CTDSP2))
- Alternative Name
- CTDSP2 (CTDSP2 Products)
- Synonyms
- fb16c04 antibody, wu:fb16c04 antibody, zgc:77714 antibody, MGC68415 antibody, CTDSP2 antibody, OS4 antibody, PSR2 antibody, SCP2 antibody, AI586070 antibody, D10Ertd73e antibody, OS-4 antibody, CTD (carboxy-terminal domain, RNA polymerase II, polypeptide A) small phosphatase 2 antibody, CTD small phosphatase 2 L homeolog antibody, CTD small phosphatase 2 antibody, ctdsp2 antibody, ctdsp2.L antibody, CTDSP2 antibody, Ctdsp2 antibody
- Background
- CTDSP2 preferentially catalyzes the dephosphorylation of 'Ser-5' within the tandem 7 residues repeats in the C-terminal domain (CTD) of the largest RNA polymerase II subunit POLR2A.
- Molecular Weight
- 31 kDa (MW of target protein)
- Pathways
- ER-Nucleus Signaling
-