TBC1D26 antibody (Middle Region)

Catalog No. ABIN632465

Product Details anti-TBC1D26 Antibody

Target: TBC1D26 (TBC1 Domain Family, Member 26 (TBC1D26))

Binding Specificity: Middle Region

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This TBC1D26 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: MGC51025 antibody was raised against the middle region of Mgc51025

Purification: Affinity purified

Immunogen: MGC51025 antibody was raised using the middle region of Mgc51025 corresponding to a region with amino acids RGRAWSLLLDIDRIKSQNPGKYKVMKEKGKRSSRIIHCIQLDVSHTLQKH

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

MGC51025 Blocking Peptide, catalog no. 33R-7932, is also available for use as a blocking control in assays to test for specificity of this MGC51025 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MGC51025 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for TBC1D26

Target: TBC1D26 (TBC1 Domain Family, Member 26 (TBC1D26))

Abstract: TBC1D26 Products

Synonyms: TBC1 domain family member 26 antibody, TBC1D26 antibody

Background: MGC51025 may act as a GTPase-activating protein for Rab family proteins.

Molecular Weight: 29 kDa (MW of target protein)