TWF1 antibody
-
- Target See all TWF1 Antibodies
- TWF1 (Twinfilin, Actin-Binding Protein 1 (TWF1))
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This TWF1 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- TWF1 antibody was raised using a synthetic peptide corresponding to a region with amino acids MSHQTGIQASEDVKEIFARARNGKYRLLKISIENEQLVIGSYSQPSDSWD
- Top Product
- Discover our top product TWF1 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
TWF1 Blocking Peptide, catalog no. 33R-6441, is also available for use as a blocking control in assays to test for specificity of this TWF1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TWF1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- TWF1 (Twinfilin, Actin-Binding Protein 1 (TWF1))
- Alternative Name
- TWF1 (TWF1 Products)
- Synonyms
- A6 antibody, PTK9 antibody, Ptk9 antibody, twinfilin antibody, ptk9 antibody, twf1 antibody, wu:fd02b03 antibody, zgc:65922 antibody, DKFZp469O1925 antibody, CG3771 antibody, Dmel\\CG3771 antibody, EG:9D2.3 antibody, zgc:92472 antibody, twinfilin actin binding protein 1 antibody, twinfilin actin-binding protein 1a antibody, twinfilin actin binding protein 1 S homeolog antibody, twinfilin-1 antibody, hypothetical protein antibody, Twinfilin-1 antibody, twinfilin actin-binding protein 1 antibody, CG3771 gene product from transcript CG3771-RC antibody, twinfilin actin-binding protein 1b antibody, TWF1 antibody, Twf1 antibody, twf1a antibody, twf1.S antibody, PTRG_09288 antibody, PGTG_01788 antibody, Tsp_02530 antibody, twf1 antibody, a6 antibody, twf1b antibody
- Background
- This gene encodes twinfilin, an actin monomer-binding protein conserved from yeast to mammals. Studies of the mouse counterpart suggest that this protein may be an actin monomer-binding protein.
- Molecular Weight
- 44 kDa (MW of target protein)
- Pathways
- Regulation of Actin Filament Polymerization, Maintenance of Protein Location
-