GLOD4 antibody (Middle Region)
-
- Target See all GLOD4 Antibodies
- GLOD4 (Glyoxalase Domain Containing 4 (GLOD4))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human, Mouse
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This GLOD4 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- GLOD4 antibody was raised against the middle region of GLOD4
- Purification
- Affinity purified
- Immunogen
- GLOD4 antibody was raised using the middle region of GLOD4 corresponding to a region with amino acids LAVSDLQKSLNYWCNLLGMKIYEKDEEKQRALLGYADNQCKLELQGVKGG
- Top Product
- Discover our top product GLOD4 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
GLOD4 Blocking Peptide, catalog no. 33R-4809, is also available for use as a blocking control in assays to test for specificity of this GLOD4 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GLOD4 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- GLOD4 (Glyoxalase Domain Containing 4 (GLOD4))
- Alternative Name
- GLOD4 (GLOD4 Products)
- Synonyms
- MGC76089 antibody, MGC84515 antibody, wu:fj45g03 antibody, zgc:103490 antibody, C17orf25 antibody, HC71 antibody, 1700082G03Rik antibody, 2700085E05Rik antibody, C81254 antibody, RGD1307010 antibody, glyoxalase domain containing 4 antibody, glyoxalase domain containing 4 L homeolog antibody, glod4 antibody, glod4.L antibody, GLOD4 antibody, Glod4 antibody
- Background
- The function of GLOD4 protein is not widely studied, and is yet to be elucidated fully.
- Molecular Weight
- 33 kDa (MW of target protein)
-