KCTD9 antibody (Middle Region)

Catalog No. ABIN632479

Product Details anti-KCTD9 Antibody

Target: KCTD9 (Potassium Channel Tetramerisation Domain Containing 9 (KCTD9))

Binding Specificity: Middle Region

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This KCTD9 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: KCTD9 antibody was raised against the middle region of KCTD9

Purification: Affinity purified

Immunogen: KCTD9 antibody was raised using the middle region of KCTD9 corresponding to a region with amino acids AHANLCCANLERADLSGSVLDCANLQGVKMLCSNAEGASLKLCNFEDPSG

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

KCTD9 Blocking Peptide, catalog no. 33R-1239, is also available for use as a blocking control in assays to test for specificity of this KCTD9 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KCTD9 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for KCTD9

Target: KCTD9 (Potassium Channel Tetramerisation Domain Containing 9 (KCTD9))

Alternative Name: KCTD9 (KCTD9 Products)

Synonyms: zgc:101020 antibody, KCTD9 antibody, MGC159927 antibody, kctd9 antibody, AA675328 antibody, AI854539 antibody, BTBD27 antibody, potassium channel tetramerization domain containing 9 antibody, potassium channel tetramerization domain containing 9b antibody, potassium channel tetramerization domain containing 9a antibody, potassium channel tetramerization domain containing 9 S homeolog antibody, potassium channel tetramerisation domain containing 9 antibody, KCTD9 antibody, kctd9b antibody, kctd9a antibody, kctd9.S antibody, kctd9 antibody, Kctd9 antibody

Background: The function of KCTD9 protein is not widely studied, and is yet to be elucidated fully.

Molecular Weight: 42 kDa (MW of target protein)