KCTD9 antibody (Middle Region)
-
- Target See all KCTD9 products
- KCTD9 (Potassium Channel Tetramerisation Domain Containing 9 (KCTD9))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This KCTD9 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- KCTD9 antibody was raised against the middle region of KCTD9
- Purification
- Affinity purified
- Immunogen
- KCTD9 antibody was raised using the middle region of KCTD9 corresponding to a region with amino acids AHANLCCANLERADLSGSVLDCANLQGVKMLCSNAEGASLKLCNFEDPSG
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
KCTD9 Blocking Peptide, catalog no. 33R-1239, is also available for use as a blocking control in assays to test for specificity of this KCTD9 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KCTD9 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- KCTD9 (Potassium Channel Tetramerisation Domain Containing 9 (KCTD9))
- Alternative Name
- KCTD9 (KCTD9 Products)
- Synonyms
- zgc:101020 antibody, KCTD9 antibody, MGC159927 antibody, kctd9 antibody, AA675328 antibody, AI854539 antibody, BTBD27 antibody, potassium channel tetramerization domain containing 9 antibody, potassium channel tetramerization domain containing 9b antibody, potassium channel tetramerization domain containing 9a antibody, potassium channel tetramerization domain containing 9 S homeolog antibody, potassium channel tetramerisation domain containing 9 antibody, KCTD9 antibody, kctd9b antibody, kctd9a antibody, kctd9.S antibody, kctd9 antibody, Kctd9 antibody
- Background
- The function of KCTD9 protein is not widely studied, and is yet to be elucidated fully.
- Molecular Weight
- 42 kDa (MW of target protein)
-