ACOT2 antibody (Middle Region)

Catalog No. ABIN632503

Product Details anti-ACOT2 Antibody

Target: ACOT2 (Acyl-CoA Thioesterase 2 (ACOT2))

Binding Specificity: Middle Region

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ACOT2 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: ACOT2 antibody was raised against the middle region of ACOT2

Purification: Affinity purified

Immunogen: ACOT2 antibody was raised using the middle region of ACOT2 corresponding to a region with amino acids SPLEGPDQKSFIPVERAESTFLFLVGQDDHNWKSEFYANEACKRLQAHGR

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

ACOT2 Blocking Peptide, catalog no. 33R-8680, is also available for use as a blocking control in assays to test for specificity of this ACOT2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ACOT2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for ACOT2

Target: ACOT2 (Acyl-CoA Thioesterase 2 (ACOT2))

Alternative Name: ACOT2 (ACOT2 Products)

Synonyms: MGC83099 antibody, CTE-IA antibody, CTE1A antibody, MTE1 antibody, PTE2 antibody, PTE2A antibody, ZAP128 antibody, AA571646 antibody, MTE-I antibody, Mte1 antibody, acyl-CoA thioesterase 2 S homeolog antibody, acyl-CoA thioesterase 2 antibody, acyl-coenzyme A thioesterase 1 antibody, acot2.S antibody, ACOT2 antibody, LOC490770 antibody, acot2 antibody, LOC100344509 antibody, Acot2 antibody

Background: Acyl-CoA thioesterases, such as ACOT2, are a group of enzymes that hydrolyze CoA esters, such as acyl-CoAs, bile CoAs, and CoA esters of prostaglandins, to the corresponding free acid and CoA.

Molecular Weight: 53 kDa (MW of target protein)

Pathways: Monocarboxylic Acid Catabolic Process