TRAPPC1 antibody (Middle Region)

Catalog No. ABIN632552

Product Details anti-TRAPPC1 Antibody

Target: TRAPPC1 (Trafficking Protein Particle Complex 1 (TRAPPC1))

Binding Specificity: Middle Region

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This TRAPPC1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: TRAPPC1 antibody was raised against the middle region of TRAPPC1

Purification: Affinity purified

Immunogen: TRAPPC1 antibody was raised using the middle region of TRAPPC1 corresponding to a region with amino acids YKLMYGMLFSIRSFVSKMSPLDMKDGFLAFQTSRYKLHYYETPTGIKVVM

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

TRAPPC1 Blocking Peptide, catalog no. 33R-10152, is also available for use as a blocking control in assays to test for specificity of this TRAPPC1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TRAPPC1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for TRAPPC1

Target: TRAPPC1 (Trafficking Protein Particle Complex 1 (TRAPPC1))

Alternative Name: TRAPPC1 (TRAPPC1 Products)

Synonyms: BET5 antibody, MUM2 antibody, D11Ertd172e antibody, zgc:100969 antibody, MGC83988 antibody, bet5 antibody, mum2 antibody, trafficking protein particle complex 1 antibody, trafficking protein particle complex 1 L homeolog antibody, TRAPPC1 antibody, Trappc1 antibody, trappc1 antibody, trappc1.L antibody

Background: This gene product plays a role in vesicular transport of proteins to the Golgi apparatus from the endoplasmic reticulum. The encoded protein is a component of the multisubunit transport protein particle (TRAPP) complex. Alternative splicing results in multiple transcript variants.

Molecular Weight: 17 kDa (MW of target protein)