DNAJC12 antibody

Catalog No. ABIN632555

Product Details anti-DNAJC12 Antibody

Target: DNAJC12 (DnaJ (Hsp40) Homolog, Subfamily C, Member 12 (DNAJC12))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This DNAJC12 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: DNAJC12 antibody was raised using a synthetic peptide corresponding to a region with amino acids EQKEPKPLEKSVSPQNSDSSGFADVNGWHLRFRWSKDAPSELLRKFRNYE

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

DNAJC12 Blocking Peptide, catalog no. 33R-2668, is also available for use as a blocking control in assays to test for specificity of this DNAJC12 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DNAJC12 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for DNAJC12

Target: DNAJC12 (DnaJ (Hsp40) Homolog, Subfamily C, Member 12 (DNAJC12))

Alternative Name: DNAJC12 (DNAJC12 Products)

Synonyms: DNAJC12 antibody, JDP1 antibody, Jdp1 antibody, mJDP1 antibody, DnaJ heat shock protein family (Hsp40) member C12 antibody, DnaJ (Hsp40) homolog, subfamily C, member 12 antibody, DNAJC12 antibody, dnajc12 antibody, Dnajc12 antibody

Background: This gene encodes a member of a subclass of the HSP40/DnaJ protein family. Members of this family of proteins are associated with complex assembly, protein folding, and export. Two transcript variants encoding distinct isoforms have been identified for this gene.

Molecular Weight: 23 kDa (MW of target protein)