SRR antibody (Middle Region)
-
- Target See all SRR Antibodies
- SRR (Serine Racemase (SRR))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This SRR antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- SRR antibody was raised against the middle region of SRR
- Purification
- Affinity purified
- Immunogen
- SRR antibody was raised using the middle region of SRR corresponding to a region with amino acids GVGVAAVLSQHFQTVSPEVKNICIVLSGGNVDLTSSITWVKQAERPASYQ
- Top Product
- Discover our top product SRR Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
SRR Blocking Peptide, catalog no. 33R-3639, is also available for use as a blocking control in assays to test for specificity of this SRR antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SRR antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- SRR (Serine Racemase (SRR))
- Alternative Name
- SRR (SRR Products)
- Synonyms
- DDBDRAFT_0188432 antibody, DDBDRAFT_0230209 antibody, DDB_0188432 antibody, DDB_0230209 antibody, ilv1 antibody, iso1 antibody, ILV1 antibody, ISO1 antibody, Srs antibody, serine racemase antibody, Serine racemase antibody, SRR antibody, srr antibody, NGR_b19540 antibody, ZPR_3642 antibody, MGYG_07950 antibody, Halhy_2637 antibody, Runsl_3290 antibody, Srr antibody
- Background
- SRR catalyzes the synthesis of D-serine from L-serine.
- Molecular Weight
- 36 kDa (MW of target protein)
-