PNMA-Like 1 antibody (Middle Region)

Catalog No. ABIN632561

Product Details anti-PNMA-Like 1 Antibody

Target: PNMA-Like 1 (PNMAL1)

Binding Specificity: Middle Region

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PNMA-Like 1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: PNMAL1 antibody was raised against the middle region of PNMAL1

Purification: Affinity purified

Immunogen: PNMAL1 antibody was raised using the middle region of PNMAL1 corresponding to a region with amino acids APMRKKKKVSLGPVSYVLVDSEDGRKKPVMPKKGPGSRREASDQKAPRGQ

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

PNMAL1 Blocking Peptide, catalog no. 33R-1430, is also available for use as a blocking control in assays to test for specificity of this PNMAL1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PNMAL1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for PNMA-Like 1

Target: PNMA-Like 1 (PNMAL1)

Alternative Name: PNMAL1 (PNMAL1 Products)

Synonyms: RGD1310803 antibody, DKFZp459A1032 antibody, DKFZp459P0514 antibody, 0710005I19Rik antibody, paraneoplastic Ma antigen family member 8A antibody, PNMA family member 8A antibody, PNMA-like 1 antibody, Pnma8a antibody, PNMA8A antibody, PNMAL1 antibody, Pnmal1 antibody

Background: The function of PNMAL1 protein is not widely studied, and is yet to be elucidated fully.

Molecular Weight: 48 kDa (MW of target protein)