CAMK1D antibody (Middle Region)

Catalog No. ABIN632564

Product Details anti-CAMK1D Antibody

Target: CAMK1D (Calcium/calmodulin-Dependent Protein Kinase ID (CAMK1D))

Binding Specificity: Middle Region

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This CAMK1D antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: CAMK1 D antibody was raised against the middle region of CAMK1

Purification: Affinity purified

Immunogen: CAMK1 D antibody was raised using the middle region of CAMK1 corresponding to a region with amino acids KNIHESVSAQIRKNFAKSKWRQAFNATAVVRHMRKLHLGSSLDSSNASVS

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

CAMK1D Blocking Peptide, catalog no. 33R-4567, is also available for use as a blocking control in assays to test for specificity of this CAMK1D antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CAMK0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for CAMK1D

Target: CAMK1D (Calcium/calmodulin-Dependent Protein Kinase ID (CAMK1D))

Alternative Name: CAMK1D (CAMK1D Products)

Background: This gene encodes a member of the Ca2+/calmodulin-dependent protein kinase 1 subfamily of serine/threonine kinases. The encoded protein may be involved in the regulation of granulocyte function through the chemokine signal transduction pathway. Alternatively spliced transcript variants encoding different isoforms of this gene have been described.

Molecular Weight: 42 kDa (MW of target protein)