MSRA antibody (Middle Region)

Catalog No. ABIN632567

Product Details anti-MSRA Antibody

Target: MSRA (Methionine Sulfoxide Reductase A (MSRA))

Binding Specificity: Middle Region

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This MSRA antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: MSRA antibody was raised against the middle region of MSRA

Purification: Affinity purified

Immunogen: MSRA antibody was raised using the middle region of MSRA corresponding to a region with amino acids YQKVLSEHGFGPITTDIREGQTFYYAEDYHQQYLSKNPNGYCGLGGTGVS

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

MSRA Blocking Peptide, catalog no. 33R-10213, is also available for use as a blocking control in assays to test for specificity of this MSRA antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MSRA antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for MSRA

Target: MSRA (Methionine Sulfoxide Reductase A (MSRA))

Alternative Name: MSRA (MSRA Products)

Synonyms: 2310045J23Rik antibody, 6530413P12Rik antibody, MSR-A antibody, PMSR antibody, methionine sulfoxide reductase A antibody, Msra antibody, MSRA antibody

Background: This protein is ubiquitous and highly conserved. It carries out the enzymatic reduction of methionine sulfoxide to methionine. Human and animal studies have shown the highest levels of expression in kidney and nervous tissue. Its proposed function is the repair of oxidative damage to proteins to restore biological activity. Three transcript variants encoding different isoforms have been found for this gene.

Molecular Weight: 26 kDa (MW of target protein)