C1orf104 antibody (Middle Region)

Catalog No. ABIN632571

Product Details anti-C1orf104 Antibody

Target: C1orf104 (Chromosome 1 Open Reading Frame 104 (C1orf104))

Binding Specificity: Middle Region

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This C1orf104 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: C1 orf104 antibody was raised against the middle region of C1 rf104

Purification: Affinity purified

Immunogen: C1 orf104 antibody was raised using the middle region of C1 rf104 corresponding to a region with amino acids APLSCPAPRAQVHRSTPMGRALLTRVLLEPLRPWACPRLPRSPPGGAQSG

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

C1orf104 Blocking Peptide, catalog no. 33R-1428, is also available for use as a blocking control in assays to test for specificity of this C1orf104 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C0 rf104 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for C1orf104

Target: C1orf104 (Chromosome 1 Open Reading Frame 104 (C1orf104))

Alternative Name: C1orf104 (C1orf104 Products)

Synonyms: C1orf104 antibody, RP11-21N7.3 antibody, RUSC1 antisense RNA 1 antibody, RUSC1-AS1 antibody

Background: The function of Chromosome 1 ORF protein is not widely studied, and is yet to be elucidated fully.

Molecular Weight: 24 kDa (MW of target protein)