TBC1D24 antibody (Middle Region)
-
- Target See all TBC1D24 Antibodies
- TBC1D24 (TBC1 Domain Family, Member 24 (TBC1D24))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This TBC1D24 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- TBC1 D24 antibody was raised against the middle region of TBC1 24
- Purification
- Affinity purified
- Immunogen
- TBC1 D24 antibody was raised using the middle region of TBC1 24 corresponding to a region with amino acids SDPADRLSPFLAARHFNLPSKTESMFMAGGSDCLIVGGGGGQALYIDGDL
- Top Product
- Discover our top product TBC1D24 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
TBC1D24 Blocking Peptide, catalog no. 33R-8365, is also available for use as a blocking control in assays to test for specificity of this TBC1D24 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TBC0 24 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- TBC1D24 (TBC1 Domain Family, Member 24 (TBC1D24))
- Alternative Name
- TBC1D24 (TBC1D24 Products)
- Synonyms
- RGD1306143 antibody, EIEE16 antibody, FIME antibody, TLDC6 antibody, 9630033P11 antibody, C530046L02Rik antibody, mKIAA1171 antibody, tbc1d24 antibody, TBC1 domain family, member 24 antibody, ATPase H+ transporting V0 subunit c antibody, TBC1 domain family member 24 antibody, TBC1 domain family member 24 L homeolog antibody, Tbc1d24 antibody, ATP6V0C antibody, TBC1D24 antibody, tbc1d24.1.L antibody
- Background
- TBC1D24 may act as a GTPase-activating protein for Rab family proteins.
- Molecular Weight
- 62 kDa (MW of target protein)
-