SAPS1 antibody (N-Term)

Catalog No. ABIN632640

Product Details anti-SAPS1 Antibody

Target: SAPS1 (SAPS Domain Family, Member 1 (SAPS1))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SAPS1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: PPP6 R1 antibody was raised against the N terminal of PPP6 1

Purification: Affinity purified

Immunogen: PPP6 R1 antibody was raised using the N terminal of PPP6 1 corresponding to a region with amino acids MFWKFDLHTSSHLDTLLEREDLSLPELLDEEDVLQECKVVNRKLLDFLLQ

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

PPP6R1 Blocking Peptide, catalog no. 33R-6008, is also available for use as a blocking control in assays to test for specificity of this PPP6R1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PPP0 1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for SAPS1

Target: SAPS1 (SAPS Domain Family, Member 1 (SAPS1))

Alternative Name: PPP6R1 (SAPS1 Products)

Synonyms: KIAA1115 antibody, PP6R1 antibody, SAP190 antibody, SAPS1 antibody, 2010309P17Rik antibody, AI836219 antibody, B430201G11Rik antibody, D030074N20Rik antibody, Pp6r1 antibody, Saps1 antibody, mKIAA1115 antibody, RGD1311409 antibody, pp6r1 antibody, MGC69001 antibody, protein phosphatase 6 regulatory subunit 1 antibody, protein phosphatase 6, regulatory subunit 1 antibody, protein phosphatase 6 regulatory subunit 1 L homeolog antibody, PPP6R1 antibody, Ppp6r1 antibody, ppp6r1.L antibody

Background: Protein phosphatase regulatory subunits, such as SAPS1, modulate the activity of protein phosphatase catalytic subunits by restricting substrate specificity, recruiting substrates, and determining the intracellular localization of the holoenzyme. SAPS1 is a regulatory subunit for the protein phosphatase-6 catalytic subunit.

Molecular Weight: 97 kDa (MW of target protein)