OSBPL1A antibody (Middle Region)

Catalog No. ABIN632643

Product Details anti-OSBPL1A Antibody

Target: OSBPL1A (Oxysterol Binding Protein-Like 1A (OSBPL1A))

Binding Specificity: Middle Region

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This OSBPL1A antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: OSBPL1 A antibody was raised against the middle region of OSBPL1

Purification: Affinity purified

Immunogen: OSBPL1 A antibody was raised using the middle region of OSBPL1 corresponding to a region with amino acids EGEHLGSRKHRMSEEKDCGGGDALSNGIKKHRTSLPSPMFSRNDFSIWSI

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

OSBPL1A Blocking Peptide, catalog no. 33R-2425, is also available for use as a blocking control in assays to test for specificity of this OSBPL1A antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of OSBPL0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for OSBPL1A

Target: OSBPL1A (Oxysterol Binding Protein-Like 1A (OSBPL1A))

Alternative Name: OSBPL1A (OSBPL1A Products)

Synonyms: ORP-1 antibody, ORP1 antibody, OSBPL1B antibody, G430090F17Rik antibody, Gm753 antibody, Osbpl1b antibody, si:dkey-121a11.8 antibody, DKFZp459N1538 antibody, oxysterol binding protein like 1A antibody, oxysterol binding protein-like 1A antibody, oxysterol-binding protein-related protein 1 antibody, oxysterol binding protein like 1A L homeolog antibody, OSBPL1A antibody, Osbpl1a antibody, osbpl1a antibody, Tsp_09273 antibody, Tsp_03387 antibody, osbpl1a.L antibody

Background: This gene encodes a member of the oxysterol-binding protein (OSBP) family, a group of intracellular lipid receptors. Most members contain an N-terminal pleckstrin homology domain and a highly conserved C-terminal OSBP-like sterol-binding domain, although some members contain only the sterol-binding domain. Transcript variants derived from alternative promoter usage and/or alternative splicing exist, they encode different isoforms.

Molecular Weight: 108 kDa (MW of target protein)