Amyloid beta (A4) Precursor Protein-Binding, Family B, Member 1 Interacting Protein (APBB1IP) (N-Term) antibody

Catalog No. ABIN632668

Product Details

Target: Amyloid beta (A4) Precursor Protein-Binding, Family B, Member 1 Interacting Protein (APBB1IP)

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: Un-conjugated

Application: Western Blotting (WB)

Specificity: APBB1 IP antibody was raised against the N terminal Of Apbb1 p

Purification: Affinity purified

Immunogen: APBB1 IP antibody was raised using the N terminal Of Apbb1 p corresponding to a region with amino acids LVADISEAEQRTIQAQKESLQNQHHSASLQASIFSGAASLGYGTNVAATG

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

APBB1IP Blocking Peptide, catalog no. 33R-5496, is also available for use as a blocking control in assays to test for specificity of this APBB1IP antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of APBB0 P antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details

Target: Amyloid beta (A4) Precursor Protein-Binding, Family B, Member 1 Interacting Protein (APBB1IP)

Alternative Name: APBB1IP (APBB1IP Products)

Synonyms: zgc:63968 antibody, apbb1ip antibody, MGC80693 antibody, APBB1IP antibody, INAG1 antibody, PREL1 antibody, RARP1 antibody, RIAM antibody, 9930118P07Rik antibody, Prp48 antibody, amyloid beta (A4) precursor protein-binding, family B, member 1 interacting protein antibody, amyloid beta (A4) precursor protein-binding, family B, member 1 interacting protein S homeolog antibody, amyloid beta precursor protein binding family B member 1 interacting protein antibody, amyloid beta A4 precursor protein-binding family B member 1-interacting protein antibody, apbb1ip antibody, apbb1ip.S antibody, APBB1IP antibody, LOC707383 antibody, LOC100439620 antibody, LOC100598478 antibody, Apbb1ip antibody

Background: APBB1IP appears to function in the signal transduction from Ras activation to actin cytoskeletal remodeling. APBB1IP suppresses insulin-induced promoter activities through AP1 and SRE. APBB1IP mediates Rap1-induced adhesion.

Molecular Weight: 73 kDa (MW of target protein)