C2orf47 antibody (Middle Region)

Catalog No. ABIN632673

Product Details anti-C2orf47 Antibody

Target: C2orf47 (Chromosome 2 Open Reading Frame 47 (C2orf47))

Binding Specificity: Middle Region

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This C2orf47 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: C2 ORF47 antibody was raised against the middle region of C2 rf47

Purification: Affinity purified

Immunogen: C2 ORF47 antibody was raised using the middle region of C2 rf47 corresponding to a region with amino acids GASVFQVKLGNQNVETKQLLSASYEFQREFTQGVKPDWTIARIEHSKLLE

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

C2ORF47 Blocking Peptide, catalog no. 33R-3173, is also available for use as a blocking control in assays to test for specificity of this C2ORF47 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C0 RF47 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for C2orf47

Target: C2orf47 (Chromosome 2 Open Reading Frame 47 (C2orf47))

Alternative Name: C2ORF47 (C2orf47 Products)

Synonyms: C12H2orf47 antibody, C2orf47 antibody, chromosome 7 open reading frame, human C2orf47 antibody, matrix AAA peptidase interacting protein 1 antibody, matrix AAA peptidase interacting protein 1 L homeolog antibody, C7H2ORF47 antibody, MAIP1 antibody, maip1 antibody, maip1.L antibody

Background: The function of the C2orf47 protein has not been widely studied, and is yet to be fully elucidated.

Molecular Weight: 32 kDa (MW of target protein)