C20orf160 antibody (N-Term)

Catalog No. ABIN632706

Product Details anti-C20orf160 Antibody

Target: C20orf160 (Chromosome 20 Open Reading Frame 160 (C20orf160))

Binding Specificity: N-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This C20orf160 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: C20 ORF160 antibody was raised against the N terminal Of C20 rf160

Purification: Affinity purified

Immunogen: C20 ORF160 antibody was raised using the N terminal Of C20 rf160 corresponding to a region with amino acids LTWVTSSLNPSSRDELLQLLDTARQLKELPLKTTAEQDSILSLSARCLLL

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

C20ORF160 Blocking Peptide, catalog no. 33R-5492, is also available for use as a blocking control in assays to test for specificity of this C20ORF160 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C20 RF160 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for C20orf160

Target: C20orf160 (Chromosome 20 Open Reading Frame 160 (C20orf160))

Alternative Name: C20ORF160 (C20orf160 Products)

Synonyms: C20orf160 antibody, dJ310O13.5 antibody, C20H20orf160 antibody, CCM2 like scaffolding protein antibody, cerebral cavernous malformation 2-like antibody, CCM2L antibody, Ccm2l antibody

Background: The specific function of C20orf160 is not yet known.

Molecular Weight: 47 kDa (MW of target protein)