CCDC151 antibody (Middle Region)

Catalog No. ABIN632726

Product Details anti-CCDC151 Antibody

Target: CCDC151 (Coiled-Coil Domain Containing 151 (CCDC151))

Binding Specificity: Middle Region

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This CCDC151 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: MGC20983 antibody was raised against the middle region of Mgc20983

Purification: Affinity purified

Immunogen: MGC20983 antibody was raised using the middle region of Mgc20983 corresponding to a region with amino acids IALPLATSKDKFFDEESEEEDNEVVTRASLKIRSQKLIESHKKHRRSRRS

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

MGC20983 Blocking Peptide, catalog no. 33R-3894, is also available for use as a blocking control in assays to test for specificity of this MGC20983 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MGC20983 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for CCDC151

Target: CCDC151 (Coiled-Coil Domain Containing 151 (CCDC151))

Alternative Name: MGC20983 (CCDC151 Products)

Synonyms: AI644415 antibody, C330001K17Rik antibody, coiled-coil domain containing 151 antibody, CCDC151 antibody, Ccdc151 antibody

Background: The function of the MGC20983 protein has not been widely studied, and is yet to be fully elucidated.

Molecular Weight: 69 kDa (MW of target protein)