MLKL antibody (N-Term)

Catalog No. ABIN632746

Product Details anti-MLKL Antibody

Target: MLKL (Mixed Lineage Kinase Domain-Like (MLKL))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This MLKL antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: MLKL antibody was raised against the N terminal of MLKL

Purification: Affinity purified

Immunogen: MLKL antibody was raised using the N terminal of MLKL corresponding to a region with amino acids DVWKELSLLLQVEQRMPVSPISQGASWAQEDQQDADEDRRAFQMLRRDNE

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

MLKL Blocking Peptide, catalog no. 33R-2230, is also available for use as a blocking control in assays to test for specificity of this MLKL antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MLKL antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for MLKL

Target: MLKL (Mixed Lineage Kinase Domain-Like (MLKL))

Alternative Name: MLKL (MLKL Products)

Synonyms: MLKL antibody, 9130019I15Rik antibody, mixed lineage kinase domain like pseudokinase antibody, mixed lineage kinase domain-like antibody, MLKL antibody, mlkl antibody, Mlkl antibody

Background: The function of MLKL protein is not widely studied, and is yet to be elucidated fully.

Molecular Weight: 54 kDa (MW of target protein)