MLKL antibody (N-Term)
-
- Target See all MLKL Antibodies
- MLKL (Mixed Lineage Kinase Domain-Like (MLKL))
-
Binding Specificity
- N-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This MLKL antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- MLKL antibody was raised against the N terminal of MLKL
- Purification
- Affinity purified
- Immunogen
- MLKL antibody was raised using the N terminal of MLKL corresponding to a region with amino acids DVWKELSLLLQVEQRMPVSPISQGASWAQEDQQDADEDRRAFQMLRRDNE
- Top Product
- Discover our top product MLKL Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
MLKL Blocking Peptide, catalog no. 33R-2230, is also available for use as a blocking control in assays to test for specificity of this MLKL antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MLKL antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- MLKL (Mixed Lineage Kinase Domain-Like (MLKL))
- Alternative Name
- MLKL (MLKL Products)
- Synonyms
- MLKL antibody, 9130019I15Rik antibody, mixed lineage kinase domain like pseudokinase antibody, mixed lineage kinase domain-like antibody, MLKL antibody, mlkl antibody, Mlkl antibody
- Background
- The function of MLKL protein is not widely studied, and is yet to be elucidated fully.
- Molecular Weight
- 54 kDa (MW of target protein)
-