LRRC56 antibody (N-Term)

Catalog No. ABIN632776

Product Details anti-LRRC56 Antibody

Target: LRRC56 (Leucine Rich Repeat Containing 56 (LRRC56))

Binding Specificity: N-Term

Reactivity: Human, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This LRRC56 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: LRRC56 antibody was raised against the N terminal of LRRC56

Purification: Affinity purified

Immunogen: LRRC56 antibody was raised using the N terminal of LRRC56 corresponding to a region with amino acids LEMCVDTREGSLGNFGVHLPNLDQLKLNGSHLGSLRDLGTSLGHLQVLWL

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

LRRC56 Blocking Peptide, catalog no. 33R-4915, is also available for use as a blocking control in assays to test for specificity of this LRRC56 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LRRC56 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for LRRC56

Target: LRRC56 (Leucine Rich Repeat Containing 56 (LRRC56))

Alternative Name: LRRC56 (LRRC56 Products)

Synonyms: 5730427C23Rik antibody, BB110509 antibody, mFLJ00101 antibody, RGD1311654 antibody, leucine rich repeat containing 56 antibody, LRRC56 antibody, Lrrc56 antibody

Background: LRRC56 contains 3 LRR (leucine-rich) repeats. The exact function of LRRC56 remains unknown.

Molecular Weight: 59 kDa (MW of target protein)