MAU2/KIAA0892 antibody (Middle Region)

Catalog No. ABIN632809

Product Details anti-MAU2/KIAA0892 Antibody

Target: MAU2/KIAA0892 (MAU2) (MAU2 Sister Chromatid Cohesion Factor (MAU2))

Binding Specificity: Middle Region

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This MAU2/KIAA0892 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: KIAA0892 antibody was raised against the middle region of KIAA0892

Purification: Affinity purified

Immunogen: KIAA0892 antibody was raised using the middle region of KIAA0892 corresponding to a region with amino acids MHQNFSQQLLQDHIEACSLPEHNLITWTDGPPPVQFQAQNGPNTSLASLL

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

KIAA0892 Blocking Peptide, catalog no. 33R-6099, is also available for use as a blocking control in assays to test for specificity of this KIAA0892 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KIAA0892 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for MAU2/KIAA0892

Target: MAU2/KIAA0892 (MAU2) (MAU2 Sister Chromatid Cohesion Factor (MAU2))

Alternative Name: KIAA0892 (MAU2 Products)

Synonyms: scc4 antibody, mau-2 antibody, kiaa0892 antibody, 9130404D08Rik antibody, A930019L04Rik antibody, C77863 antibody, C79014 antibody, Mau-2 antibody, mKIAA0892 antibody, KIAA0892 antibody, MAU2L antibody, SCC4 antibody, MAU2 sister chromatid cohesion factor antibody, MAU2, sister chromatid cohesion factor antibody, MAU2, sister chromatid cohesion factor S homeolog antibody, MAU2 antibody, mau2 antibody, mau2.S antibody, Mau2 antibody

Background: KIAA0892 belongs to the mau-2 family. It contains 4 TPR repeats. The function of KIAA0892 remains unknown.

Molecular Weight: 69 kDa (MW of target protein)