AAMDC antibody (Middle Region)

Catalog No. ABIN632818

Product Details anti-AAMDC Antibody

Target: AAMDC (Adipogenesis Associated Mth938 Domain Containing (AAMDC))

Binding Specificity: Middle Region

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This AAMDC antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: C11 ORF67 antibody was raised against the middle region of C11 rf67

Purification: Affinity purified

Immunogen: C11 ORF67 antibody was raised using the middle region of C11 rf67 corresponding to a region with amino acids SEALKVPSSTVEYLKKHGIDVRVLQTEQAVKEYNALVAQGVRVGGVFHST

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

C11ORF67 Blocking Peptide, catalog no. 33R-8383, is also available for use as a blocking control in assays to test for specificity of this C11ORF67 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C10 RF67 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for AAMDC

Target: AAMDC (Adipogenesis Associated Mth938 Domain Containing (AAMDC))

Alternative Name: C11ORF67 (AAMDC Products)

Synonyms: C11orf67 antibody, C29H11orf67 antibody, c11orf67 antibody, zgc:112239 antibody, CK067 antibody, RGD1561459 antibody, 1810020D17Rik antibody, 1810037D19Rik antibody, LI2 antibody, adipogenesis associated Mth938 domain containing antibody, adipogenesis associated, Mth938 domain containing antibody, AAMDC antibody, aamdc antibody, Aamdc antibody

Background: The function of C11orf67 protein has not been widely studied, and is yet to be fully elucidated.

Molecular Weight: 13 kDa (MW of target protein)