ZCCHC13 antibody (Middle Region)

Catalog No. ABIN632852

Product Details anti-ZCCHC13 Antibody

Target: ZCCHC13 (Zinc Finger, C3HC-Type Containing 13 (ZCCHC13))

Binding Specificity: Middle Region

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ZCCHC13 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: ZCCHC13 antibody was raised against the middle region of ZCCHC13

Purification: Affinity purified

Immunogen: ZCCHC13 antibody was raised using the middle region of ZCCHC13 corresponding to a region with amino acids GKLGHIQKDCAQVKCYRCGEIGHVAINCSKARPGQLLPLRQIPTSSQGMS

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

ZCCHC13 Blocking Peptide, catalog no. 33R-3370, is also available for use as a blocking control in assays to test for specificity of this ZCCHC13 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ZCCHC13 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for ZCCHC13

Target: ZCCHC13 (Zinc Finger, C3HC-Type Containing 13 (ZCCHC13))

Alternative Name: ZCCHC13 (ZCCHC13 Products)

Synonyms: CNBP2 antibody, ZNF9L antibody, zinc finger CCHC-type containing 13 antibody, ZCCHC13 antibody

Background: The function of ZCCHC13 protein is not widely studied, and is yet to be elucidated fully.

Molecular Weight: 18 kDa (MW of target protein)