KIAA1191 antibody (Middle Region)
-
- Target See all KIAA1191 Antibodies
- KIAA1191
-
Binding Specificity
- Middle Region
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This KIAA1191 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- KIAA1191 antibody was raised against the middle region of KIAA1191
- Purification
- Affinity purified
- Immunogen
- KIAA1191 antibody was raised using the middle region of KIAA1191 corresponding to a region with amino acids TPHSSPKQRPRGWFTSGSSTALPGPNPSTMDSGSGDKDRNLSDKWSLFGP
- Top Product
- Discover our top product KIAA1191 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
KIAA1191 Blocking Peptide, catalog no. 33R-9222, is also available for use as a blocking control in assays to test for specificity of this KIAA1191 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KIAA1191 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- KIAA1191
- Alternative Name
- KIAA1191 (KIAA1191 Products)
- Synonyms
- p60MONOX antibody, 4930558H15Rik antibody, C81457 antibody, Kiaa1191 antibody, P33monox antibody, P33MONOX antibody, p33monox antibody, DKFZp469A246 antibody, KIAA1191 antibody, RIKEN cDNA 4833439L19 gene antibody, KIAA1191 L homeolog antibody, KIAA1191 ortholog antibody, KIAA1191 antibody, 4833439L19Rik antibody, kiaa1191.L antibody, kiaa1191 antibody, Kiaa1191 antibody
- Background
- The function of KIAA1191 protein is not widely studied, and is yet to be elucidated fully.
- Molecular Weight
- 33 kDa (MW of target protein)
-