TBC1D25 antibody (N-Term)

Catalog No. ABIN632894

Product Details anti-TBC1D25 Antibody

Target: TBC1D25 (TBC1 Domain Family, Member 25 (TBC1D25))

Binding Specificity: N-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This TBC1D25 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: TBC1 D25 antibody was raised against the N terminal of TBC1 25

Purification: Affinity purified

Immunogen: TBC1 D25 antibody was raised using the N terminal of TBC1 25 corresponding to a region with amino acids KVQQVLSWSYGEDVKPFKPPLSDAEFHTYLNHEGQLSRPEELRLRIYHGG

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

TBC1D25 Blocking Peptide, catalog no. 33R-4721, is also available for use as a blocking control in assays to test for specificity of this TBC1D25 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TBC0 25 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for TBC1D25

Target: TBC1D25 (TBC1 Domain Family, Member 25 (TBC1D25))

Alternative Name: TBC1D25 (TBC1D25 Products)

Synonyms: im:7137114 antibody, si:dkeyp-22b2.2 antibody, MG81 antibody, OATL1 antibody, 6330576A08Rik antibody, A530047E07 antibody, DXHXS7927e antibody, Oatl1 antibody, mMg81 antibody, RGD1559711 antibody, TBC1 domain family member 25 antibody, TBC1 domain family, member 25 antibody, TBC1D25 antibody, tbc1d25 antibody, Tbc1d25 antibody

Background: This gene encodes a protein with a TBC domain and may function as a Rab GTPase activating protein. This gene was previously known as ornithine aminotransferase-like 1, but has no similarity to ornithine aminotransferase.

Molecular Weight: 76 kDa (MW of target protein)