PSMD3 antibody
-
- Target See all PSMD3 Antibodies
- PSMD3 (Proteasome (Prosome, Macropain) 26S Subunit, Non-ATPase, 3 (PSMD3))
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This PSMD3 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- PSMD3 antibody was raised using a synthetic peptide corresponding to a region with amino acids RLNHYVLYKAVQGFFTSNNATRDFLLPFLEEPMDTEADLQFRPRTGKAAS
- Top Product
- Discover our top product PSMD3 Primary Antibody
-
anti-Proteasome (Prosome, Macropain) 26S Subunit, Non-ATPase, 3 (PSMD3) antibody
PSMD3 Reactivity: Human, Mouse, Rat, Dog, Monkey WB, FACS Host: Mouse Monoclonal 2A2 unconjugated
anti-Proteasome (Prosome, Macropain) 26S Subunit, Non-ATPase, 3 (PSMD3) (AA 482-515) antibodyPSMD3 Reactivity: Human, Mouse WB, FACS, IHC (p) Host: Rabbit Polyclonal RB55247 unconjugated
anti-Proteasome (Prosome, Macropain) 26S Subunit, Non-ATPase, 3 (PSMD3) antibodyPSMD3 Reactivity: Human WB, IHC, ELISA Host: Rabbit Polyclonal unconjugated
anti-Proteasome (Prosome, Macropain) 26S Subunit, Non-ATPase, 3 (PSMD3) (C-Term) antibodyPSMD3 Reactivity: Human, Mouse, Rat WB, IHC, ELISA, IF, ICC Host: Rabbit Polyclonal unconjugated
anti-Proteasome (Prosome, Macropain) 26S Subunit, Non-ATPase, 3 (PSMD3) (N-Term) antibodyPSMD3 Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit WB Host: Rabbit Polyclonal unconjugated
anti-Proteasome (Prosome, Macropain) 26S Subunit, Non-ATPase, 3 (PSMD3) antibodyPSMD3 Reactivity: Human, Mouse, Rat IHC Host: Rabbit Polyclonal unconjugated
anti-Proteasome (Prosome, Macropain) 26S Subunit, Non-ATPase, 3 (PSMD3) (AA 107-156) antibodyPSMD3 Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Monkey, Pig WB Host: Rabbit Polyclonal unconjugated
anti-Proteasome (Prosome, Macropain) 26S Subunit, Non-ATPase, 3 (PSMD3) (C-Term) antibodyPSMD3 Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Monkey, Rabbit, Pig, Bat, Chicken, Xenopus laevis WB Host: Rabbit Polyclonal unconjugated
anti-Proteasome (Prosome, Macropain) 26S Subunit, Non-ATPase, 3 (PSMD3) antibodyPSMD3 Reactivity: Saccharomyces cerevisiae WB, IP Host: Rabbit Polyclonal unconjugated
anti-Proteasome (Prosome, Macropain) 26S Subunit, Non-ATPase, 3 (PSMD3) (Middle Region) antibodyPSMD3 Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Saccharomyces cerevisiae, Zebrafish (Danio rerio) WB Host: Rabbit Polyclonal unconjugated
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
PSMD3 Blocking Peptide, catalog no. 33R-8042, is also available for use as a blocking control in assays to test for specificity of this PSMD3 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PSMD3 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- PSMD3 (Proteasome (Prosome, Macropain) 26S Subunit, Non-ATPase, 3 (PSMD3))
- Alternative Name
- PSMD3 (PSMD3 Products)
- Synonyms
- P58 antibody, RPN3 antibody, S3 antibody, TSTA2 antibody, AI255837 antibody, AntP91a antibody, D11Bwg1349e antibody, Psd3 antibody, Tstap91a antibody, proteasome 26S subunit, non-ATPase 3 antibody, proteasome 26S subunit, non-ATPase 3 S homeolog antibody, proteasome (prosome, macropain) 26S subunit, non-ATPase, 3 antibody, 26S proteasome non-ATPase regulatory subunit 3 antibody, PSMD3 antibody, psmd3.S antibody, Psmd3 antibody, rpn-3 antibody
- Background
- The 26S proteasome is a multicatalytic proteinase complex with a highly ordered structure composed of 2 complexes, a 20S core and a 19S regulator.
- Molecular Weight
- 61 kDa (MW of target protein)
- Pathways
- Mitotic G1-G1/S Phases, DNA Replication, Synthesis of DNA, Ubiquitin Proteasome Pathway
-
