PSMC4 antibody

Catalog No. ABIN632907

Product Details anti-PSMC4 Antibody

Target: PSMC4 (Proteasome (Prosome, Macropain) 26S Subunit, ATPase, 4 (PSMC4))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PSMC4 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: PSMC4 antibody was raised using a synthetic peptide corresponding to a region with amino acids MEEIGILVEKAQDEIPALSVSRPQTGLSFLGPEPEDLEDLYSRYKKLQQE

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

PSMC4 Blocking Peptide, catalog no. 33R-5903, is also available for use as a blocking control in assays to test for specificity of this PSMC4 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PSMC4 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for PSMC4

Target: PSMC4 (Proteasome (Prosome, Macropain) 26S Subunit, ATPase, 4 (PSMC4))

Alternative Name: PSMC4 (PSMC4 Products)

Synonyms: NCU02260.1 antibody, AO090003000692 antibody, DDBDRAFT_0188209 antibody, DDBDRAFT_0191435 antibody, DDB_0188209 antibody, DDB_0191435 antibody, MIP224 antibody, RPT3 antibody, S6 antibody, TBP-7 antibody, TBP7 antibody, CIP21 antibody, Tbp7 antibody, 26S protease regulatory subunit 6B antibody, regulatory particle, ATPase-like-3 antibody, 26S proteasome regulatory subunit 6B antibody, proteasome 26S subunit, ATPase 4 antibody, proteasome (prosome, macropain) 26S subunit, ATPase, 4 antibody, LOC732870 antibody, rpt-3 antibody, ATEG_04674 antibody, LELG_01296 antibody, HCAG_00039 antibody, LOC5568998 antibody, GL50803_7950 antibody, EDI_044950 antibody, AOR_1_1218154 antibody, PTRG_03339 antibody, psmC4 antibody, prs6b antibody, LOC100381342 antibody, psmc4 antibody, PSMC4 antibody, Psmc4 antibody

Background: The 26S proteasome is a multicatalytic proteinase complex with a highly ordered structure composed of 2 complexes, a 20S core and a 19S regulator.

Molecular Weight: 47 kDa (MW of target protein)

Pathways: Mitotic G1-G1/S Phases, DNA Replication, Synthesis of DNA, Ubiquitin Proteasome Pathway