RP2 antibody

Catalog No. ABIN632908

Product Details anti-RP2 Antibody

Target: RP2 (Retinitis Pigmentosa 2 (X-Linked Recessive) (RP2))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This RP2 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: RP2 antibody was raised using a synthetic peptide corresponding to a region with amino acids LEFNGDGAVEVCQLIVNEIFNGTKMFVSESKETASGDVDSFYNFADIQMG

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

RP2 Blocking Peptide, catalog no. 33R-4895, is also available for use as a blocking control in assays to test for specificity of this RP2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RP2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for RP2

Target: RP2 (Retinitis Pigmentosa 2 (X-Linked Recessive) (RP2))

Alternative Name: RP2 (RP2 Products)

Synonyms: Rp2h antibody, RGD1565124 antibody, RP2 antibody, wu:fj10e02 antibody, wu:fm72d05 antibody, zfrp2 antibody, zgc:55632 antibody, DELXp11.3 antibody, NM23-H10 antibody, NME10 antibody, TBCCD2 antibody, XRP2 antibody, AI662636 antibody, Rp2 antibody, RP2, ARL3 GTPase activating protein antibody, XRP2 protein antibody, XRP2-like protein antibody, retinitis pigmentosa 2 (X-linked recessive) antibody, RP2, ARL3 GTPase activating protein S homeolog antibody, retinitis pigmentosa 2 homolog antibody, Rp2 antibody, RP2 antibody, Bm1_36735 antibody, PITG_13367 antibody, LOAG_11813 antibody, rp2 antibody, rp2.S antibody

Background: The RP2 locus has been implicated as one cause of X-linked retinitis pigmentosa. The predicted gene product shows homology with human cofactor C, a protein involved in the ultimate step of beta-tubulin folding.

Molecular Weight: 40 kDa (MW of target protein)

Pathways: Nucleotide Phosphorylation, Ribonucleoside Biosynthetic Process