HSD17B14 antibody

Catalog No. ABIN632920

Product Details anti-HSD17B14 Antibody

Target: HSD17B14 (Hydroxysteroid (17-Beta) Dehydrogenase 14 (HSD17B14))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This HSD17B14 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: HSD17 B14 antibody was raised using a synthetic peptide corresponding to a region with amino acids RVVICDKDESGGRALEQELPGAVFILCDVTQEDDVKTLVSETIRRFGRLD

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

HSD17B14 Blocking Peptide, catalog no. 33R-8259, is also available for use as a blocking control in assays to test for specificity of this HSD17B14 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HSD10 14 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for HSD17B14

Target: HSD17B14 (Hydroxysteroid (17-Beta) Dehydrogenase 14 (HSD17B14))

Alternative Name: HSD17B14 (HSD17B14 Products)

Synonyms: Dhrs10 antibody, retSDR3 antibody, 0610039E24Rik antibody, DHRS10 antibody, SDR47C1 antibody, SDR3 antibody, hydroxysteroid (17-beta) dehydrogenase 14 antibody, hydroxysteroid 17-beta dehydrogenase 14 antibody, Hsd17b14 antibody, HSD17B14 antibody

Background: 17-beta-hydroxysteroid dehydrogenases, such as HSD17B14, are primarily involved in metabolism of steroids at the C17 position and also of other substrates, such as fatty acids, prostaglandins, and xenobiotics.

Molecular Weight: 28 kDa (MW of target protein)