HSD17B14 antibody
-
- Target See all HSD17B14 Antibodies
- HSD17B14 (Hydroxysteroid (17-Beta) Dehydrogenase 14 (HSD17B14))
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This HSD17B14 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- HSD17 B14 antibody was raised using a synthetic peptide corresponding to a region with amino acids RVVICDKDESGGRALEQELPGAVFILCDVTQEDDVKTLVSETIRRFGRLD
- Top Product
- Discover our top product HSD17B14 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
HSD17B14 Blocking Peptide, catalog no. 33R-8259, is also available for use as a blocking control in assays to test for specificity of this HSD17B14 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HSD10 14 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- HSD17B14 (Hydroxysteroid (17-Beta) Dehydrogenase 14 (HSD17B14))
- Alternative Name
- HSD17B14 (HSD17B14 Products)
- Synonyms
- Dhrs10 antibody, retSDR3 antibody, 0610039E24Rik antibody, DHRS10 antibody, SDR47C1 antibody, SDR3 antibody, hydroxysteroid (17-beta) dehydrogenase 14 antibody, hydroxysteroid 17-beta dehydrogenase 14 antibody, Hsd17b14 antibody, HSD17B14 antibody
- Background
- 17-beta-hydroxysteroid dehydrogenases, such as HSD17B14, are primarily involved in metabolism of steroids at the C17 position and also of other substrates, such as fatty acids, prostaglandins, and xenobiotics.
- Molecular Weight
- 28 kDa (MW of target protein)
-