MIER2 antibody (Middle Region)
-
- Target See all MIER2 Antibodies
- MIER2 (Mesoderm Induction Early Response 1, Family Member 2 (MIER2))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This MIER2 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- MIER2 antibody was raised against the middle region of MIER2
- Purification
- Affinity purified
- Immunogen
- MIER2 antibody was raised using the middle region of MIER2 corresponding to a region with amino acids RLRFNVKVIRDGLCAWSEEECRNFEHGFRVHGKNFHLIQANKVRTRSVGE
- Top Product
- Discover our top product MIER2 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
MIER2 Blocking Peptide, catalog no. 33R-8048, is also available for use as a blocking control in assays to test for specificity of this MIER2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MIER2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- MIER2 (Mesoderm Induction Early Response 1, Family Member 2 (MIER2))
- Alternative Name
- MIER2 (MIER2 Products)
- Synonyms
- KIAA1193 antibody, Mi-er2 antibody, 2700087H15Rik antibody, mKIAA1193 antibody, RGD1307278 antibody, mesoderm induction early response 1, family member 2 S homeolog antibody, mesoderm induction early response 1, family member 2 antibody, MIER family member 2 antibody, mier2.S antibody, mier2 antibody, MIER2 antibody, Mier2 antibody
- Background
- MIER2 is a transcriptional repressor.
- Molecular Weight
- 60 kDa (MW of target protein)
- Pathways
- Chromatin Binding
-