TASP1 antibody (Middle Region)

Catalog No. ABIN632927

Product Details anti-TASP1 Antibody

Target: TASP1 (Taspase, Threonine Aspartase, 1 (TASP1))

Binding Specificity: Middle Region

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This TASP1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: TASP1 antibody was raised against the middle region of TASP1

Purification: Affinity purified

Immunogen: TASP1 antibody was raised using the middle region of TASP1 corresponding to a region with amino acids QNKQTLLVEFLWSHTTESMCVGYMSAQDGKAKTHISRLPPGAVAGQSVAI

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

TASP1 Blocking Peptide, catalog no. 33R-7663, is also available for use as a blocking control in assays to test for specificity of this TASP1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TASP1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for TASP1

Target: TASP1 (Taspase, Threonine Aspartase, 1 (TASP1))

Alternative Name: TASP1 (TASP1 Products)

Synonyms: 4930485D02Rik antibody, AW986064 antibody, RGD1308591 antibody, C20orf13 antibody, dJ585I14.2 antibody, taspase, threonine aspartase 1 antibody, taspase 1 antibody, Tasp1 antibody, TASP1 antibody

Background: This gene encodes an endopeptidase that cleaves specific substrates following aspartate residues. The encoded protein undergoes posttranslational autoproteolytic processing to generate alpha and beta subunits.

Molecular Weight: 19 kDa (MW of target protein)