RIC8B antibody
-
- Target See all RIC8B Antibodies
- RIC8B (Resistance To Inhibitors of Cholinesterase 8 Homolog B (RIC8B))
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This RIC8B antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- RIC8 B antibody was raised using a synthetic peptide corresponding to a region with amino acids KETVLKNNTMVYNGMNMEAIHVLLNFMEKRIDKGSSYREGLTPVLSLLTE
- Top Product
- Discover our top product RIC8B Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
RIC8B Blocking Peptide, catalog no. 33R-4361, is also available for use as a blocking control in assays to test for specificity of this RIC8B antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RIC0 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- RIC8B (Resistance To Inhibitors of Cholinesterase 8 Homolog B (RIC8B))
- Alternative Name
- RIC8B (RIC8B Products)
- Synonyms
- DKFZp469H2225 antibody, BC051080 antibody, Ric-8 antibody, Ric-8b antibody, RIC8 antibody, hSyn antibody, RIC8 guanine nucleotide exchange factor B antibody, RIC8B antibody, Ric8b antibody
- Background
- RIC8B is a guanine nucleotide exchange factor (GEF), which can activate some, but not all, G-alpha proteins by exchanging bound GDP for free GTP (By similarity). Able to potentiate G(olf)-alpha-dependent cAMP accumulation suggesting that it may be an important component for odorant signal transduction.
- Molecular Weight
- 59 kDa (MW of target protein)
- Pathways
- Regulation of G-Protein Coupled Receptor Protein Signaling
-