SPATA7 antibody (Middle Region)
-
- Target See all SPATA7 Antibodies
- SPATA7 (Spermatogenesis Associated 7 (SPATA7))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This SPATA7 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- SPATA7 antibody was raised against the middle region of SPATA7
- Purification
- Affinity purified
- Immunogen
- SPATA7 antibody was raised using the middle region of SPATA7 corresponding to a region with amino acids FLSQYRYYTPAKRKKDFTDQRIEAETQTELSFKSELGTAETKNMTDSEMN
- Top Product
- Discover our top product SPATA7 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
SPATA7 Blocking Peptide, catalog no. 33R-2989, is also available for use as a blocking control in assays to test for specificity of this SPATA7 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SPATA7 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- SPATA7 (Spermatogenesis Associated 7 (SPATA7))
- Alternative Name
- SPATA7 (SPATA7 Products)
- Synonyms
- HSD-3.1 antibody, HSD3 antibody, LCA3 antibody, AI661438 antibody, B230306G18Rik antibody, RSD-3 antibody, Wmp1 antibody, spermatogenesis associated 7 antibody, SPATA7 antibody, Spata7 antibody
- Background
- The gene which encodes the SPATA7 protein is also expressed in retina. Mutations in this gene are associated with Leber congenital amaurosis and juvenile retinitis pigmentosa. Alternatively spliced transcript variants encoding different isoforms have been found.
- Molecular Weight
- 68 kDa (MW of target protein)
-