CCDC74A antibody (Middle Region)

Catalog No. ABIN632959

Product Details anti-CCDC74A Antibody

Target: CCDC74A (Coiled-Coil Domain Containing 74A (CCDC74A))

Binding Specificity: Middle Region

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This CCDC74A antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: CCDC74 A antibody was raised against the middle region of CCDC74

Purification: Affinity purified

Immunogen: CCDC74 A antibody was raised using the middle region of CCDC74 corresponding to a region with amino acids FPKVSTKSLSKKCLSPPVAERAILPALKQTPKNNFAERQKRLQAMQKRRL

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

CCDC74A Blocking Peptide, catalog no. 33R-3020, is also available for use as a blocking control in assays to test for specificity of this CCDC74A antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CCDC70 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for CCDC74A

Target: CCDC74A (Coiled-Coil Domain Containing 74A (CCDC74A))

Alternative Name: CCDC74A (CCDC74A Products)

Synonyms: 2310015A05Rik antibody, coiled-coil domain containing 74A antibody, CCDC74A antibody, Ccdc74a antibody

Background: The function of CCDC74A protein has not been widely studied, and is yet to be fully elucidated.

Molecular Weight: 42 kDa (MW of target protein)