HYLS1 antibody (Middle Region)
-
- Target See all HYLS1 Antibodies
- HYLS1 (Hydrolethalus Syndrome 1 (HYLS1))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This HYLS1 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- HYLS1 antibody was raised against the middle region of HYLS1
- Purification
- Affinity purified
- Immunogen
- HYLS1 antibody was raised using the middle region of HYLS1 corresponding to a region with amino acids YFEYKRDWDSIRLPGEDHRKELRWGVREQMLCRAEPQSKPQHIYVPNNYL
- Top Product
- Discover our top product HYLS1 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
HYLS1 Blocking Peptide, catalog no. 33R-10093, is also available for use as a blocking control in assays to test for specificity of this HYLS1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HYLS1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- HYLS1 (Hydrolethalus Syndrome 1 (HYLS1))
- Alternative Name
- HYLS1 (HYLS1 Products)
- Synonyms
- HLS antibody, 3010015K02Rik antibody, HYLS1, centriolar and ciliogenesis associated antibody, HYLS1 antibody, Hyls1 antibody
- Background
- This protein is a protein localized to the cytoplasm. Mutations in this protein are associated with hydrolethalus syndrome.
- Molecular Weight
- 34 kDa (MW of target protein)
-