HYLS1 antibody (Middle Region)

Catalog No. ABIN632964

Product Details anti-HYLS1 Antibody

Target: HYLS1 (Hydrolethalus Syndrome 1 (HYLS1))

Binding Specificity: Middle Region

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This HYLS1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: HYLS1 antibody was raised against the middle region of HYLS1

Purification: Affinity purified

Immunogen: HYLS1 antibody was raised using the middle region of HYLS1 corresponding to a region with amino acids YFEYKRDWDSIRLPGEDHRKELRWGVREQMLCRAEPQSKPQHIYVPNNYL

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

HYLS1 Blocking Peptide, catalog no. 33R-10093, is also available for use as a blocking control in assays to test for specificity of this HYLS1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HYLS1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for HYLS1

Target: HYLS1 (Hydrolethalus Syndrome 1 (HYLS1))

Alternative Name: HYLS1 (HYLS1 Products)

Synonyms: HLS antibody, 3010015K02Rik antibody, HYLS1, centriolar and ciliogenesis associated antibody, HYLS1 antibody, Hyls1 antibody

Background: This protein is a protein localized to the cytoplasm. Mutations in this protein are associated with hydrolethalus syndrome.

Molecular Weight: 34 kDa (MW of target protein)