DIP2A antibody

Catalog No. ABIN632976

Product Details anti-DIP2A Antibody

Target: DIP2A (DIP2 Disco-Interacting Protein 2 Homolog A (DIP2A))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This DIP2A antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: DIP2 A antibody was raised using a synthetic peptide corresponding to a region with amino acids PLKEFFVDDFEELLEVQQPDPNQPKPEGSETSVLRGEPLTAGVPRPPSLL

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

DIP2A Blocking Peptide, catalog no. 33R-7196, is also available for use as a blocking control in assays to test for specificity of this DIP2A antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DIP0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for DIP2A

Target: DIP2A (DIP2 Disco-Interacting Protein 2 Homolog A (DIP2A))

Alternative Name: DIP2A (DIP2A Products)

Synonyms: C21orf106 antibody, Dip2-like antibody, DIP2 antibody, 4931420H10Rik antibody, AI426328 antibody, Dip2 antibody, Kiaa0184-hp antibody, mKIAA0184 antibody, disco-interacting protein 2 homolog A antibody, disco interacting protein 2 homolog A antibody, Dip2a antibody, DIP2A antibody

Background: The protein encoded by this gene may be involved in axon patterning in the central nervous system. This gene is not highly expressed. Several transcript variants encoding different isoforms have been found for this gene.

Molecular Weight: 170 kDa (MW of target protein)

Pathways: M Phase