Cytohesin 4 antibody (N-Term)

Catalog No. ABIN632981

Product Details anti-Cytohesin 4 Antibody

Target: Cytohesin 4 (CYTH4)

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Cytohesin 4 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: PSCD4 antibody was raised against the N terminal of PSCD4

Purification: Affinity purified

Immunogen: PSCD4 antibody was raised using the N terminal of PSCD4 corresponding to a region with amino acids NKTAIGTYLGERDPINLQVLQAFVDCHEFANLNLVQALRQFLWSFRLPGE

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

PSCD4 Blocking Peptide, catalog no. 33R-6747, is also available for use as a blocking control in assays to test for specificity of this PSCD4 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PSCD4 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for Cytohesin 4

Target: Cytohesin 4 (CYTH4)

Alternative Name: PSCD4 (CYTH4 Products)

Synonyms: zgc:175224 antibody, CYT4 antibody, DJ63G5.1 antibody, PSCD4 antibody, 2510004M07Rik antibody, 5830469K17Rik antibody, AI467541 antibody, Pscd4 antibody, mFLJ00017 antibody, RGD1564842 antibody, cytohesin-4 antibody, cytohesin 4b antibody, cytohesin 4 antibody, cyth4b antibody, CYTH4 antibody, Cyth4 antibody

Background: PSCD4 promotes guanine-nucleotide exchange on ARF1 and ARF5. PSCD4 promotes the activation of ARF through replacement of GDP with GTP.Pleckstrin homology, Sec7 and coiled/coil domains 4 (PSCD4) is a member of the PSCD family. Members of this family have identical structural organization that consists of an N-terminal coiled-coil motif, a central Sec7 domain, and a C-terminal pleckstrin homology (PH) domain.

Molecular Weight: 46 kDa (MW of target protein)