C15orf26/CFAP161 antibody (C-Term)

Catalog No. ABIN632983

Product Details anti-C15orf26/CFAP161 Antibody

Target: C15orf26/CFAP161 (C15orf26) (Chromosome 15 Open Reading Frame 26 (C15orf26))

Binding Specificity: C-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This C15orf26/CFAP161 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: C15 ORF26 antibody was raised against the C terminal Of C15 rf26

Purification: Affinity purified

Immunogen: C15 ORF26 antibody was raised using the C terminal Of C15 rf26 corresponding to a region with amino acids LINHCHTNRGLAAHRHLFLSTYFGKEAEVVAHTYLDSHRVEKPRNHWMLV

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

C15ORF26 Blocking Peptide, catalog no. 33R-5056, is also available for use as a blocking control in assays to test for specificity of this C15ORF26 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C10 RF26 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for C15orf26/CFAP161

Target: C15orf26/CFAP161 (C15orf26) (Chromosome 15 Open Reading Frame 26 (C15orf26))

Alternative Name: C15ORF26 (C15orf26 Products)

Synonyms: 1700026D08Rik antibody, AW047638 antibody, AW551802 antibody, C21H15orf26 antibody, cilia and flagella associated protein 161 antibody, cilia and flagella associated protein 161 L homeolog antibody, CFAP161 antibody, cfap161.L antibody, cfap161 antibody, Cfap161 antibody

Background: The function of C15orf26 protein has not been widely studied, and is yet to be fully elucidated.

Molecular Weight: 34 kDa (MW of target protein)